Lineage for d1p0xa_ (1p0x A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 359341Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 359342Superfamily a.104.1: Cytochrome P450 [48264] (1 family) (S)
  5. 359343Family a.104.1.1: Cytochrome P450 [48265] (19 proteins)
  6. 359381Protein Cytochrome P450 bm-3 [48268] (1 species)
  7. 359382Species Bacillus megaterium [TaxId:1404] [48269] (11 PDB entries)
  8. 359389Domain d1p0xa_: 1p0x A: [93880]

Details for d1p0xa_

PDB Entry: 1p0x (more details), 2 Å

PDB Description: f393y mutant heme domain of flavocytochrome p450 bm3

SCOP Domain Sequences for d1p0xa_:

Sequence, based on SEQRES records: (download)

>d1p0xa_ a.104.1.1 (A:) Cytochrome P450 bm-3 {Bacillus megaterium}
kempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlikeac
desrfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyhammvdi
avqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvrald
eamnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmlngkd
petgeplddeniryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarvlvdpv
psykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipqlhr
dktiwgddveefrperfenpsaipqhafkpygngqracigqqfalheatlvlgmmlkhfd
fedhtnyeldiketltlkpegfvvkakskkipl

Sequence, based on observed residues (ATOM records): (download)

>d1p0xa_ a.104.1.1 (A:) Cytochrome P450 bm-3 {Bacillus megaterium}
kempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlikeac
desrfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyhammvdi
avqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvrald
eamnklnkrqfqedikvmndlvdkiiadrkasgeqsddllthmlngkdpetgeplddeni
ryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarvlvdpvpsykqvkqlkyv
gmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipqlhrdktiwgddveef
rperfenpsaipqhafkpygngqracigqqfalheatlvlgmmlkhfdfedhtnyeldik
etltlkpegfvvkakskkipl

SCOP Domain Coordinates for d1p0xa_:

Click to download the PDB-style file with coordinates for d1p0xa_.
(The format of our PDB-style files is described here.)

Timeline for d1p0xa_: