Lineage for d1p0vb_ (1p0v B:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 646332Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 646333Superfamily a.104.1: Cytochrome P450 [48264] (1 family) (S)
  5. 646334Family a.104.1.1: Cytochrome P450 [48265] (21 proteins)
  6. 646395Protein Cytochrome P450 bm-3 [48268] (1 species)
  7. 646396Species Bacillus megaterium [TaxId:1404] [48269] (18 PDB entries)
  8. 646414Domain d1p0vb_: 1p0v B: [93877]
    complexed with hem; mutant

Details for d1p0vb_

PDB Entry: 1p0v (more details), 2.05 Å

PDB Description: f393a mutant heme domain of flavocytochrome p450 bm3
PDB Compounds: (B:) bifunctional p-450:nadph-p450 reductase

SCOP Domain Sequences for d1p0vb_:

Sequence, based on SEQRES records: (download)

>d1p0vb_ a.104.1.1 (B:) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]}
kempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlikeac
desrfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyhammvdi
avqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvrald
eamnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmlngkd
petgeplddeniryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarvlvdpv
psykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipqlhr
dktiwgddveefrperfenpsaipqhafkpagngqracigqqfalheatlvlgmmlkhfd
fedhtnyeldiketltlkpegfvvkakskkipl

Sequence, based on observed residues (ATOM records): (download)

>d1p0vb_ a.104.1.1 (B:) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]}
kempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlikeac
desrfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyhammvdi
avqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvrald
eamnklydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmlngkdpetgepldd
eniryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarvlvdpvpsykqvkql
kyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipqlhrdktiwgddv
eefrperfenpsaipqhafkpagngqracigqqfalheatlvlgmmlkhfdfedhtnyel
diketltlkpegfvvkakskkipl

SCOP Domain Coordinates for d1p0vb_:

Click to download the PDB-style file with coordinates for d1p0vb_.
(The format of our PDB-style files is described here.)

Timeline for d1p0vb_: