Lineage for d1p0se_ (1p0s E:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 370194Fold b.16: Ecotin, trypsin inhibitor [49771] (1 superfamily)
    sandwich; 8 strands in 2 sheets; complex topology with the crossing loops
  4. 370195Superfamily b.16.1: Ecotin, trypsin inhibitor [49772] (1 family) (S)
  5. 370196Family b.16.1.1: Ecotin, trypsin inhibitor [49773] (1 protein)
  6. 370197Protein Ecotin, trypsin inhibitor [49774] (1 species)
  7. 370198Species Escherichia coli [TaxId:562] [49775] (14 PDB entries)
  8. 370217Domain d1p0se_: 1p0s E: [93872]
    Other proteins in same PDB: d1p0sh_, d1p0sl1, d1p0sl2
    complexed with mg, na; mutant

Details for d1p0se_

PDB Entry: 1p0s (more details), 2.8 Å

PDB Description: Crystal Structure of Blood Coagulation Factor Xa in Complex with Ecotin M84R

SCOP Domain Sequences for d1p0se_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p0se_ b.16.1.1 (E:) Ecotin, trypsin inhibitor {Escherichia coli}
vqplekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenkt
legwgydyyvfdkvsspvstrmacpdgkkekkfvtaylgdagmlrynsklpivvytpdnv
dvkyrvwkaeekidnavvr

SCOP Domain Coordinates for d1p0se_:

Click to download the PDB-style file with coordinates for d1p0se_.
(The format of our PDB-style files is described here.)

Timeline for d1p0se_: