Lineage for d1p0ra_ (1p0r A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 499486Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 499487Superfamily d.15.1: Ubiquitin-like [54236] (6 families) (S)
  5. 499488Family d.15.1.1: Ubiquitin-related [54237] (17 proteins)
  6. 499593Protein Ubiquitin-like protein 5, ubl5 [102779] (2 species)
  7. 499594Species Human (Homo sapiens) [TaxId:9606] [102780] (1 PDB entry)
  8. 499595Domain d1p0ra_: 1p0r A: [93871]

Details for d1p0ra_

PDB Entry: 1p0r (more details)

PDB Description: Solution Structure of UBL5 a human Ubiquitin-Like Protein

SCOP Domain Sequences for d1p0ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p0ra_ d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Human (Homo sapiens)}
mievvcndrlgkkvrvkcntddtigdlkkliaaqtgtrwnkivlkkwytifkdhvslgdy
eihdgmnlelyyq

SCOP Domain Coordinates for d1p0ra_:

Click to download the PDB-style file with coordinates for d1p0ra_.
(The format of our PDB-style files is described here.)

Timeline for d1p0ra_: