![]() | Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (6 families) ![]() |
![]() | Family d.15.1.1: Ubiquitin-related [54237] (17 proteins) |
![]() | Protein Ubiquitin-like protein 5, ubl5 [102779] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [102780] (1 PDB entry) |
![]() | Domain d1p0ra_: 1p0r A: [93871] |
PDB Entry: 1p0r (more details)
SCOP Domain Sequences for d1p0ra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p0ra_ d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Human (Homo sapiens)} mievvcndrlgkkvrvkcntddtigdlkkliaaqtgtrwnkivlkkwytifkdhvslgdy eihdgmnlelyyq
Timeline for d1p0ra_: