SCOP 1.67: Domain d1ozrb_: 1ozr B:

Lineage for d1ozrb_ (1ozr B:)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (4 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (2 proteins)

6. Protein Heme oxygenase-1 (HO-1) [48615] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48616] (9 PDB entries)

8. Domain d1ozrb_: 1ozr B: [93856]
   complexed with hem; mutant

Details for d1ozrb_

PDB Entry: 1ozr, 1.74 Å

PDB Description: Crystal Structures of the Ferric, Ferrous and Ferrous-NO Forms of the Asp140Ala Mutant of Human Heme Oxygenase-1: Catalytic Implications

SCOP Domain Sequences for d1ozrb_:

Sequence; same for both SEQRES and ATOM records:

>d1ozrb_ a.132.1.1 (B:) Heme oxygenase-1 (HO-1) {Human (Homo sapiens)}
pqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyvaleeeiernk
espvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepell
vahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyrsrmnsl
emtpavrqrvieeaktafllniqlfeelqellth

Timeline for d1ozrb_:

• d1ozrb_ is new in SCOP 1.67
  
• d1ozrb_ appears in SCOP 1.69
  
• d1ozrb_ appears in the current release, SCOPe 2.08