| Class a: All alpha proteins [46456] (202 folds) |
| Fold a.132: Heme oxygenase-like [48612] (1 superfamily) multihelical; bundle |
Superfamily a.132.1: Heme oxygenase-like [48613] (4 families) ![]() duplication: contains two structural repeats of 3-helical motif |
| Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (2 proteins) |
| Protein Heme oxygenase-1 (HO-1) [48615] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [48616] (9 PDB entries) |
| Domain d1ozrb_: 1ozr B: [93856] complexed with hem; mutant |
PDB Entry: 1ozr (more details), 1.74 Å
SCOP Domain Sequences for d1ozrb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ozrb_ a.132.1.1 (B:) Heme oxygenase-1 (HO-1) {Human (Homo sapiens)}
pqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyvaleeeiernk
espvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepell
vahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyrsrmnsl
emtpavrqrvieeaktafllniqlfeelqellth
Timeline for d1ozrb_: