Lineage for d1ozqa_ (1ozq A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 685691Superfamily c.1.20: tRNA-guanine transglycosylase [51713] (1 family) (S)
  5. 685692Family c.1.20.1: tRNA-guanine transglycosylase [51714] (2 proteins)
  6. 685703Protein Queosine tRNA-guanine transglycosylase [51715] (1 species)
    contains zinc-binding subdomain
  7. 685704Species Zymomonas mobilis [TaxId:542] [51716] (29 PDB entries)
  8. 685716Domain d1ozqa_: 1ozq A: [93854]
    complexed with prf, zn; mutant

Details for d1ozqa_

PDB Entry: 1ozq (more details), 1.9 Å

PDB Description: crystal structure of the mutated trna-guanine transglycosylase (tgt) y106f complexed with preq1
PDB Compounds: (A:) Queuine tRNA-ribosyltransferase

SCOP Domain Sequences for d1ozqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ozqa_ c.1.20.1 (A:) Queosine tRNA-guanine transglycosylase {Zymomonas mobilis [TaxId: 542]}
rprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkalkpetvratgadiilgn
tyhlmlrpgaeriaklgglhsfmgwdrpiltdsggfqvmslssltkqseegvtfkshldg
srhmlspersieiqhllgsdivmafdectpypatpsraassmersmrwakrsrdafdsrk
eqaenaalfgiqqgsvfenlrqqsadalaeigfdgyavgglavgegqdemfrvldfsvpm
lpddkphylmgvgkpddivgavergidmfdcvlptrsgrngqaftwdgpinirnarfsed
lkpldsechcavcqkwsrayihhlirageilgamlmtehniafyqqlmqkirdsisegrf
sqfaqdfraryf

SCOP Domain Coordinates for d1ozqa_:

Click to download the PDB-style file with coordinates for d1ozqa_.
(The format of our PDB-style files is described here.)

Timeline for d1ozqa_: