Lineage for d1ozob_ (1ozo B:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 914068Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 914069Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 914095Family a.39.1.2: S100 proteins [47478] (2 proteins)
    dimer: subunits are made of two EF-hands
  6. 914096Protein Calcyclin (S100) [47479] (17 species)
  7. 914242Species Human (Homo sapiens), s100p [TaxId:9606] [81755] (2 PDB entries)
  8. 914245Domain d1ozob_: 1ozo B: [93852]

Details for d1ozob_

PDB Entry: 1ozo (more details)

PDB Description: three-dimensional solution structure of apo-s100p protein determined by nmr spectroscopy
PDB Compounds: (B:) S-100P protein

SCOPe Domain Sequences for d1ozob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ozob_ a.39.1.2 (B:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]}
mteleaamgmiidvfsrysgsegstqtltkgelkvlmekelpgflqsgkdkdavdkllkd
ldangdaqvdfsefivfvaaitsashkyfektglk

SCOPe Domain Coordinates for d1ozob_:

Click to download the PDB-style file with coordinates for d1ozob_.
(The format of our PDB-style files is described here.)

Timeline for d1ozob_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ozoa_