Lineage for d1ozoa_ (1ozo A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1087624Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1087625Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1087651Family a.39.1.2: S100 proteins [47478] (2 proteins)
    dimer: subunits are made of two EF-hands
  6. 1087652Protein Calcyclin (S100) [47479] (17 species)
  7. 1087805Species Human (Homo sapiens), s100p [TaxId:9606] [81755] (2 PDB entries)
  8. 1087807Domain d1ozoa_: 1ozo A: [93851]

Details for d1ozoa_

PDB Entry: 1ozo (more details)

PDB Description: three-dimensional solution structure of apo-s100p protein determined by nmr spectroscopy
PDB Compounds: (A:) S-100P protein

SCOPe Domain Sequences for d1ozoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ozoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]}
mteleaamgmiidvfsrysgsegstqtltkgelkvlmekelpgflqsgkdkdavdkllkd
ldangdaqvdfsefivfvaaitsashkyfektglk

SCOPe Domain Coordinates for d1ozoa_:

Click to download the PDB-style file with coordinates for d1ozoa_.
(The format of our PDB-style files is described here.)

Timeline for d1ozoa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ozob_