Lineage for d1ozma_ (1ozm A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2425361Superfamily c.1.20: tRNA-guanine transglycosylase [51713] (1 family) (S)
  5. 2425362Family c.1.20.1: tRNA-guanine transglycosylase [51714] (2 protein domains)
  6. 2425373Protein Queosine tRNA-guanine transglycosylase [51715] (3 species)
    contains zinc-binding subdomain
  7. 2425402Species Zymomonas mobilis [TaxId:542] [51716] (116 PDB entries)
    Uniprot P28720
  8. 2425480Domain d1ozma_: 1ozm A: [93850]
    complexed with zn; mutant

Details for d1ozma_

PDB Entry: 1ozm (more details), 1.95 Å

PDB Description: Y106F mutant of Z. mobilis TGT
PDB Compounds: (A:) Queuine tRNA-ribosyltransferase

SCOPe Domain Sequences for d1ozma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ozma_ c.1.20.1 (A:) Queosine tRNA-guanine transglycosylase {Zymomonas mobilis [TaxId: 542]}
rprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkalkpetvratgadiilgn
tyhlmlrpgaeriaklgglhsfmgwdrpiltdsggfqvmslssltkqseegvtfkshldg
srhmlspersieiqhllgsdivmafdectpypatpsraassmersmrwakrsrdafdsrk
eqaenaalfgiqqgsvfenlrqqsadalaeigfdgyavgglavgegqdemfrvldfsvpm
lpddkphylmgvgkpddivgavergidmfdcvlptrsgrngqaftwdgpinirnarfsed
lkpldsechcavcqkwsrayihhlirageilgamlmtehniafyqqlmqkirdsisegrf
sqfaqdfraryf

SCOPe Domain Coordinates for d1ozma_:

Click to download the PDB-style file with coordinates for d1ozma_.
(The format of our PDB-style files is described here.)

Timeline for d1ozma_: