SCOPe 2.08: Domain d1ozlb_: 1ozl B:

Lineage for d1ozlb_ (1ozl B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (5 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 proteins)
   automatically mapped to Pfam PF01126

6. Protein Heme oxygenase-1 (HO-1) [48615] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48616] (26 PDB entries)
   Uniprot P09601

8. Domain d1ozlb_: 1ozl B: [93849]
   complexed with hem, no; mutant

Details for d1ozlb_

PDB Entry: 1ozl, 1.58 Å

PDB Description: crystal structures of the ferric, ferrous, and ferrous-no forms of the asp140ala mutant of human heme oxygenase-1: catalytic implications

PDB Compounds: (B:) Heme oxygenase 1

SCOPe Domain Sequences for d1ozlb_:

Sequence; same for both SEQRES and ATOM records:

>d1ozlb_ a.132.1.1 (B:) Heme oxygenase-1 (HO-1) {Human (Homo sapiens) [TaxId: 9606]}
pqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyvaleeeiernk
espvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepell
vahaytrylgalsggqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyrsrmnsl
emtpavrqrvieeaktafllniqlfeelqellth

Timeline for d1ozlb_:

• d1ozlb_ first appeared in SCOP 1.67
  
• d1ozlb_ appears in SCOPe 2.07