![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.164: SMAD MH1 domain [56365] (1 superfamily) consists of four alpha-helices and three beta-ribbons |
![]() | Superfamily d.164.1: SMAD MH1 domain [56366] (2 families) ![]() |
![]() | Family d.164.1.1: SMAD MH1 domain [56367] (2 proteins) |
![]() | Protein SMAD MH1 domain [56368] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [56369] (2 PDB entries) |
![]() | Domain d1ozja_: 1ozj A: [93846] complexed with DNA protein/DNA complex; complexed with zn |
PDB Entry: 1ozj (more details), 2.4 Å
SCOPe Domain Sequences for d1ozja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ozja_ d.164.1.1 (A:) SMAD MH1 domain {Human (Homo sapiens) [TaxId: 9606]} ftppivkrllgwkkgeqngqeekwcekavkslvkklkktgqldelekaittqnvntkcit iprsldgrlqvshrkglphviycrlwrwpdlhshhelramelcefafnmkkdevcvnpyh yqrvet
Timeline for d1ozja_: