Lineage for d1ozja_ (1ozj A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2999957Fold d.164: SMAD MH1 domain [56365] (1 superfamily)
    consists of four alpha-helices and three beta-ribbons
  4. 2999958Superfamily d.164.1: SMAD MH1 domain [56366] (2 families) (S)
  5. 2999959Family d.164.1.1: SMAD MH1 domain [56367] (2 proteins)
  6. 2999960Protein SMAD MH1 domain [56368] (1 species)
  7. 2999961Species Human (Homo sapiens) [TaxId:9606] [56369] (2 PDB entries)
  8. 2999964Domain d1ozja_: 1ozj A: [93846]
    complexed with DNA
    protein/DNA complex; complexed with zn

Details for d1ozja_

PDB Entry: 1ozj (more details), 2.4 Å

PDB Description: crystal structure of smad3-mh1 bound to dna at 2.4 a resolution
PDB Compounds: (A:) smad 3

SCOPe Domain Sequences for d1ozja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ozja_ d.164.1.1 (A:) SMAD MH1 domain {Human (Homo sapiens) [TaxId: 9606]}
ftppivkrllgwkkgeqngqeekwcekavkslvkklkktgqldelekaittqnvntkcit
iprsldgrlqvshrkglphviycrlwrwpdlhshhelramelcefafnmkkdevcvnpyh
yqrvet

SCOPe Domain Coordinates for d1ozja_:

Click to download the PDB-style file with coordinates for d1ozja_.
(The format of our PDB-style files is described here.)

Timeline for d1ozja_: