Lineage for d1ozia_ (1ozi A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 373409Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 373410Superfamily b.36.1: PDZ domain-like [50156] (4 families) (S)
    peptide-binding domain
  5. 373411Family b.36.1.1: PDZ domain [50157] (24 proteins)
  6. 373480Protein Phosphatase hPTP1e [50168] (2 species)
  7. 373485Species Mouse (Mus musculus) [TaxId:10090] [74930] (2 PDB entries)
  8. 373487Domain d1ozia_: 1ozi A: [93845]
    alternatively spliced PDZ2 domain
    mutant

Details for d1ozia_

PDB Entry: 1ozi (more details)

PDB Description: the alternatively spliced pdz2 domain of ptp-bl

SCOP Domain Sequences for d1ozia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus)}
kpgdtfevelaktdgslgisvtvlfdkggvntsvrhggiyvkaiipkgaaesdgrihkgd
rvlavngvslegathkqavetlrntgqvvhlllekgqvp

SCOP Domain Coordinates for d1ozia_:

Click to download the PDB-style file with coordinates for d1ozia_.
(The format of our PDB-style files is described here.)

Timeline for d1ozia_: