| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
| Family c.36.1.9: Pyruvate oxidase and decarboxylase PP module [88749] (8 proteins) the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology |
| Protein Catabolic acetolactate synthase [102333] (1 species) |
| Species Klebsiella pneumoniae [TaxId:573] [102334] (3 PDB entries) |
| Domain d1ozhc3: 1ozh C:367-557 [93841] Other proteins in same PDB: d1ozha1, d1ozha2, d1ozha4, d1ozhb1, d1ozhb2, d1ozhb4, d1ozhc1, d1ozhc2, d1ozhc4, d1ozhd1, d1ozhd2 complexed with he3, mg, peg, pge, po4 |
PDB Entry: 1ozh (more details), 2 Å
SCOPe Domain Sequences for d1ozhc3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ozhc3 c.36.1.9 (C:367-557) Catabolic acetolactate synthase {Klebsiella pneumoniae [TaxId: 573]}
nqfalhplrivramqdivnsdvtltvdmgsfhiwiarylytfrarqvmisngqqtmgval
pwaigawlvnperkvvsvsgdggflqssmeletavrlkanvlhliwvdngynmvaiqeek
kyqrlsgvefgpmdfkayaesfgakgfavesaealeptlraamdvdgpavvaipvdyrdn
pllmgqlhlsq
Timeline for d1ozhc3: