Lineage for d1ozhc3 (1ozh C:367-557)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2864564Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2864565Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2864860Family c.36.1.9: Pyruvate oxidase and decarboxylase PP module [88749] (8 proteins)
    the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology
  6. 2864955Protein Catabolic acetolactate synthase [102333] (1 species)
  7. 2864956Species Klebsiella pneumoniae [TaxId:573] [102334] (3 PDB entries)
  8. 2864959Domain d1ozhc3: 1ozh C:367-557 [93841]
    Other proteins in same PDB: d1ozha1, d1ozha2, d1ozha4, d1ozhb1, d1ozhb2, d1ozhb4, d1ozhc1, d1ozhc2, d1ozhc4, d1ozhd1, d1ozhd2
    complexed with he3, mg, peg, pge, po4

Details for d1ozhc3

PDB Entry: 1ozh (more details), 2 Å

PDB Description: The crystal structure of Klebsiella pneumoniae acetolactate synthase with enzyme-bound cofactor and with an unusual intermediate.
PDB Compounds: (C:) Acetolactate synthase, catabolic

SCOPe Domain Sequences for d1ozhc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ozhc3 c.36.1.9 (C:367-557) Catabolic acetolactate synthase {Klebsiella pneumoniae [TaxId: 573]}
nqfalhplrivramqdivnsdvtltvdmgsfhiwiarylytfrarqvmisngqqtmgval
pwaigawlvnperkvvsvsgdggflqssmeletavrlkanvlhliwvdngynmvaiqeek
kyqrlsgvefgpmdfkayaesfgakgfavesaealeptlraamdvdgpavvaipvdyrdn
pllmgqlhlsq

SCOPe Domain Coordinates for d1ozhc3:

Click to download the PDB-style file with coordinates for d1ozhc3.
(The format of our PDB-style files is described here.)

Timeline for d1ozhc3: