![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
![]() | Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) ![]() binds cofactor molecules in the opposite direction than classical Rossmann fold |
![]() | Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 proteins) N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold |
![]() | Protein Catabolic acetolactate synthase [102288] (1 species) |
![]() | Species Klebsiella pneumoniae [TaxId:573] [102289] (3 PDB entries) |
![]() | Domain d1ozhc1: 1ozh C:189-366 [93839] Other proteins in same PDB: d1ozha2, d1ozha3, d1ozha4, d1ozhb2, d1ozhb3, d1ozhb4, d1ozhc2, d1ozhc3, d1ozhc4, d1ozhd2, d1ozhd3 complexed with he3, mg, peg, pge, po4 |
PDB Entry: 1ozh (more details), 2 Å
SCOPe Domain Sequences for d1ozhc1:
Sequence, based on SEQRES records: (download)
>d1ozhc1 c.31.1.3 (C:189-366) Catabolic acetolactate synthase {Klebsiella pneumoniae [TaxId: 573]} mgaapddaidqvakliaqaknpifllglmasqpenskalrrlletshipvtstyqaagav nqdnfsrfagrvglfnnqagdrllqladlvicigyspveyepamwnsgnatlvhidvlpa yeernytpdvelvgdiagtlnklaqnidhrlvlspqaaeilrdrqhqrelldrrgaql
>d1ozhc1 c.31.1.3 (C:189-366) Catabolic acetolactate synthase {Klebsiella pneumoniae [TaxId: 573]} mgaapddaidqvakliaqaknpifllglmasqpenskalrrlletshipvtstyqaagav nqdnfsrfagrvglfnnqagdrllqladlvicigyspveyepamwnsgnatlvhidvlpa yeernytpdvelvgdiagtlnklaqnidhrlvlspqaaeilrdrqhqrelldraql
Timeline for d1ozhc1: