SCOP 1.69: Domain d1ozhb1: 1ozh B:188-366

Lineage for d1ozhb1 (1ozh B:188-366)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like

4. Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (5 families)
   binds cofactor molecules in the opposite direction than classical Rossmann fold

5. Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (7 proteins)
   N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold

6. Protein Catabolic acetolactate synthase [102288] (1 species)

7. Species Klebsiella pneumoniae [TaxId:573] [102289] (3 PDB entries)

8. Domain d1ozhb1: 1ozh B:188-366 [93836]
   Other proteins in same PDB: d1ozha2, d1ozha3, d1ozhb2, d1ozhb3, d1ozhc2, d1ozhc3, d1ozhd2, d1ozhd3

Details for d1ozhb1

PDB Entry: 1ozh, 2 Å

PDB Description: The crystal structure of Klebsiella pneumoniae acetolactate synthase with enzyme-bound cofactor and with an unusual intermediate.

SCOP Domain Sequences for d1ozhb1:

Sequence, based on SEQRES records:

>d1ozhb1 c.31.1.3 (B:188-366) Catabolic acetolactate synthase {Klebsiella pneumoniae}
qmgaapddaidqvakliaqaknpifllglmasqpenskalrrlletshipvtstyqaaga
vnqdnfsrfagrvglfnnqagdrllqladlvicigyspveyepamwnsgnatlvhidvlp
ayeernytpdvelvgdiagtlnklaqnidhrlvlspqaaeilrdrqhqrelldrrgaql

Sequence, based on observed residues (ATOM records):

>d1ozhb1 c.31.1.3 (B:188-366) Catabolic acetolactate synthase {Klebsiella pneumoniae}
qmaapddaidqvakliaqaknpifllglmasqpenskalrrlletshipvtstyqaagav
nqdnfsrfagrvglfnnqagdrllqladlvicigyspveyepamwnsgnatlvhidvlpa
yeernytpdvelvgdiagtlnklaqnidhrlvlspqaaeilrdrqhqrelldrrgaql

Timeline for d1ozhb1:

• d1ozhb1 first appeared in SCOP 1.67
  
• d1ozhb1 appears in SCOP 1.71
  
• d1ozhb1 appears in the current release, SCOPe 2.08