Lineage for d1ozhb1 (1ozh B:188-366)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2862578Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 2862579Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 2862632Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 proteins)
    N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold
  6. 2862787Protein Catabolic acetolactate synthase [102288] (1 species)
  7. 2862788Species Klebsiella pneumoniae [TaxId:573] [102289] (3 PDB entries)
  8. 2862790Domain d1ozhb1: 1ozh B:188-366 [93836]
    Other proteins in same PDB: d1ozha2, d1ozha3, d1ozha4, d1ozhb2, d1ozhb3, d1ozhb4, d1ozhc2, d1ozhc3, d1ozhc4, d1ozhd2, d1ozhd3
    complexed with he3, mg, peg, pge, po4

Details for d1ozhb1

PDB Entry: 1ozh (more details), 2 Å

PDB Description: The crystal structure of Klebsiella pneumoniae acetolactate synthase with enzyme-bound cofactor and with an unusual intermediate.
PDB Compounds: (B:) Acetolactate synthase, catabolic

SCOPe Domain Sequences for d1ozhb1:

Sequence, based on SEQRES records: (download)

>d1ozhb1 c.31.1.3 (B:188-366) Catabolic acetolactate synthase {Klebsiella pneumoniae [TaxId: 573]}
qmgaapddaidqvakliaqaknpifllglmasqpenskalrrlletshipvtstyqaaga
vnqdnfsrfagrvglfnnqagdrllqladlvicigyspveyepamwnsgnatlvhidvlp
ayeernytpdvelvgdiagtlnklaqnidhrlvlspqaaeilrdrqhqrelldrrgaql

Sequence, based on observed residues (ATOM records): (download)

>d1ozhb1 c.31.1.3 (B:188-366) Catabolic acetolactate synthase {Klebsiella pneumoniae [TaxId: 573]}
qmaapddaidqvakliaqaknpifllglmasqpenskalrrlletshipvtstyqaagav
nqdnfsrfagrvglfnnqagdrllqladlvicigyspveyepamwnsgnatlvhidvlpa
yeernytpdvelvgdiagtlnklaqnidhrlvlspqaaeilrdrqhqrelldrrgaql

SCOPe Domain Coordinates for d1ozhb1:

Click to download the PDB-style file with coordinates for d1ozhb1.
(The format of our PDB-style files is described here.)

Timeline for d1ozhb1: