Lineage for d1ozga3 (1ozg A:367-554)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 581036Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 581037Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 581216Family c.36.1.9: Pyruvate oxidase and decarboxylase PP module [88749] (7 proteins)
    the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology
  6. 581271Protein Catabolic acetolactate synthase [102333] (1 species)
  7. 581272Species Klebsiella pneumoniae [TaxId:573] [102334] (3 PDB entries)
  8. 581279Domain d1ozga3: 1ozg A:367-554 [93829]
    Other proteins in same PDB: d1ozga1, d1ozga2, d1ozgb1, d1ozgb2

Details for d1ozga3

PDB Entry: 1ozg (more details), 2.3 Å

PDB Description: The crystal structure of Klebsiella pneumoniae acetolactate synthase with enzyme-bound cofactor and with an unusual intermediate

SCOP Domain Sequences for d1ozga3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ozga3 c.36.1.9 (A:367-554) Catabolic acetolactate synthase {Klebsiella pneumoniae}
nqfalhplrivramqdivnsdvtltvdmgsfhiwiarylytfrarqvmisngqqtmgval
pwaigawlvnperkvvsvsgdggflqssmeletavrlkanvlhliwvdngynmvaiqeek
kyqrlsgvefgpmdfkayaesfgakgfavesaealeptlraamdvdgpavvaipvdyrdn
pllmgqlh

SCOP Domain Coordinates for d1ozga3:

Click to download the PDB-style file with coordinates for d1ozga3.
(The format of our PDB-style files is described here.)

Timeline for d1ozga3: