![]() | Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
![]() | Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
![]() | Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (5 families) ![]() binds cofactor molecules in the opposite direction than classical Rossmann fold |
![]() | Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (7 proteins) N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold |
![]() | Protein Catabolic acetolactate synthase [102288] (1 species) |
![]() | Species Klebsiella pneumoniae [TaxId:573] [102289] (3 PDB entries) |
![]() | Domain d1ozga1: 1ozg A:188-366 [93827] Other proteins in same PDB: d1ozga2, d1ozga3, d1ozgb2, d1ozgb3 |
PDB Entry: 1ozg (more details), 2.3 Å
SCOP Domain Sequences for d1ozga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ozga1 c.31.1.3 (A:188-366) Catabolic acetolactate synthase {Klebsiella pneumoniae} qmgaapddaidqvakliaqaknpifllglmasqpenskalrrlletshipvtstyqaaga vnqdnfsrfagrvglfnnqagdrllqladlvicigyspveyepamwnsgnatlvhidvlp ayeernytpdvelvgdiagtlnklaqnidhrlvlspqaaeilrdrqhqrelldrrgaql
Timeline for d1ozga1: