SCOP 1.71: Domain d1ozfb2: 1ozf B:5-187

Lineage for d1ozfb2 (1ozf B:5-187)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (7 proteins)
   the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpha/beta domain of Rossmann-like topology

6. Protein Catabolic acetolactate synthase [102328] (1 species)

7. Species Klebsiella pneumoniae [TaxId:573] [102329] (3 PDB entries)

8. Domain d1ozfb2: 1ozf B:5-187 [93825]
   Other proteins in same PDB: d1ozfa1, d1ozfa3, d1ozfb1, d1ozfb3
   complexed with mg, peg, po4, tpp

Details for d1ozfb2

PDB Entry: 1ozf, 2.3 Å

PDB Description: The crystal structure of Klebsiella pneumoniae acetolactate synthase with enzyme-bound cofactors

SCOP Domain Sequences for d1ozfb2:

Sequence, based on SEQRES records:

>d1ozfb2 c.36.1.5 (B:5-187) Catabolic acetolactate synthase {Klebsiella pneumoniae}
ypvrqwahgadlvvsqleaqgvrqvfgipgakidkvfdslldssiriipvrheanaafma
aavgritgkagvalvtsgpgcsnlitgmatansegdpvvalggavkradkakqvhqsmdt
vamfspvtkyaievtapdalaevvsnafraaeqgrpgsafvslpqdvvdgpvsgkvlpas
gap

Sequence, based on observed residues (ATOM records):

>d1ozfb2 c.36.1.5 (B:5-187) Catabolic acetolactate synthase {Klebsiella pneumoniae}
ypvrqwahgadlvvsqleaqgvrqvfgipgakidkvfdslldssiriipvrheanaafma
aavgritgkagvalvtsgpgcsnlitgmatansegdpvvalggavkradkakqsmdtvam
fspvtkyaievtapdalaevvsnafraaeqgrpgsafvslpqdvvdgpvsgkvlpap

Timeline for d1ozfb2:

• d1ozfb2 first appeared in SCOP 1.67
  
• d1ozfb2 appears in SCOP 1.69
  
• d1ozfb2 appears in SCOP 1.73
  
• d1ozfb2 appears in the current release, SCOPe 2.08