![]() | Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
![]() | Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
![]() | Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
![]() | Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (7 proteins) the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpha/beta domain of Rossmann-like topology |
![]() | Protein Catabolic acetolactate synthase [102328] (1 species) |
![]() | Species Klebsiella pneumoniae [TaxId:573] [102329] (3 PDB entries) |
![]() | Domain d1ozfa2: 1ozf A:7-187 [93822] Other proteins in same PDB: d1ozfa1, d1ozfa3, d1ozfb1, d1ozfb3 |
PDB Entry: 1ozf (more details), 2.3 Å
SCOP Domain Sequences for d1ozfa2:
Sequence, based on SEQRES records: (download)
>d1ozfa2 c.36.1.5 (A:7-187) Catabolic acetolactate synthase {Klebsiella pneumoniae} vrqwahgadlvvsqleaqgvrqvfgipgakidkvfdslldssiriipvrheanaafmaaa vgritgkagvalvtsgpgcsnlitgmatansegdpvvalggavkradkakqvhqsmdtva mfspvtkyaievtapdalaevvsnafraaeqgrpgsafvslpqdvvdgpvsgkvlpasga p
>d1ozfa2 c.36.1.5 (A:7-187) Catabolic acetolactate synthase {Klebsiella pneumoniae} vrqwahgadlvvsqleaqgvrqvfgipgakidkvfdslldssiriipvrheanaafmaaa vgritgkagvalvtsgpgcsnlitgmatansegdpvvalggavkradkakqvhqsmdtva mfspvtkyaievtapdalaevvsnafraaeqgrpgsafvslpqdvvdgpvsgkvlpap
Timeline for d1ozfa2: