Lineage for d1ozbh_ (1ozb H:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 858432Fold d.33: SecB-like [54610] (1 superfamily)
    beta(4)-alpha(2); two layers: alpha/beta; antiparallel sheet: order 1432
  4. 858433Superfamily d.33.1: SecB-like [54611] (2 families) (S)
  5. 858434Family d.33.1.1: Bacterial protein-export protein SecB [54612] (1 protein)
  6. 858435Protein Bacterial protein-export protein SecB [54613] (2 species)
  7. 858441Species Haemophilus influenzae [TaxId:727] [54614] (2 PDB entries)
  8. 858449Domain d1ozbh_: 1ozb H: [93816]
    Other proteins in same PDB: d1ozbi_, d1ozbj_
    complexed with zn

Details for d1ozbh_

PDB Entry: 1ozb (more details), 2.8 Å

PDB Description: Crystal Structure of SecB complexed with SecA C-terminus
PDB Compounds: (H:) protein-export protein secb

SCOP Domain Sequences for d1ozbh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ozbh_ d.33.1.1 (H:) Bacterial protein-export protein SecB {Haemophilus influenzae [TaxId: 727]}
pvlqiqriyvkdvsfeapnlphifqqewkpklgfdlstettqvgddlyevvlnisvettl
edsgdvaficevkqagvftisgledvqmahcltsqcpnmlfpyarelvsnlvnrgtfpal
nlspvnfdalfveymn

SCOP Domain Coordinates for d1ozbh_:

Click to download the PDB-style file with coordinates for d1ozbh_.
(The format of our PDB-style files is described here.)

Timeline for d1ozbh_: