Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.33: SecB-like [54610] (1 superfamily) beta(4)-alpha(2); two layers: alpha/beta; antiparallel sheet: order 1432 |
Superfamily d.33.1: SecB-like [54611] (2 families) |
Family d.33.1.1: Bacterial protein-export protein SecB [54612] (1 protein) automatically mapped to Pfam PF02556 |
Protein Bacterial protein-export protein SecB [54613] (2 species) |
Species Haemophilus influenzae [TaxId:727] [54614] (2 PDB entries) |
Domain d1ozbf_: 1ozb F: [93814] Other proteins in same PDB: d1ozbi_, d1ozbj_ complexed with zn |
PDB Entry: 1ozb (more details), 2.8 Å
SCOPe Domain Sequences for d1ozbf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ozbf_ d.33.1.1 (F:) Bacterial protein-export protein SecB {Haemophilus influenzae [TaxId: 727]} qpvlqiqriyvkdvsfeapnlphifqqewkpklgfdlstettqvgddlyevvlnisvett ledsgdvaficevkqagvftisgledvqmahcltsqcpnmlfpyarelvsnlvnrgtfpa lnlspvnfdalfveymnrqqaenaeeks
Timeline for d1ozbf_: