Lineage for d1ozbf_ (1ozb F:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943083Fold d.33: SecB-like [54610] (1 superfamily)
    beta(4)-alpha(2); two layers: alpha/beta; antiparallel sheet: order 1432
  4. 2943084Superfamily d.33.1: SecB-like [54611] (3 families) (S)
  5. 2943085Family d.33.1.1: Bacterial protein-export protein SecB [54612] (1 protein)
    automatically mapped to Pfam PF02556
  6. 2943086Protein Bacterial protein-export protein SecB [54613] (2 species)
  7. 2943092Species Haemophilus influenzae [TaxId:727] [54614] (2 PDB entries)
  8. 2943102Domain d1ozbf_: 1ozb F: [93814]
    Other proteins in same PDB: d1ozbi_, d1ozbj_
    complexed with zn

Details for d1ozbf_

PDB Entry: 1ozb (more details), 2.8 Å

PDB Description: Crystal Structure of SecB complexed with SecA C-terminus
PDB Compounds: (F:) protein-export protein secb

SCOPe Domain Sequences for d1ozbf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ozbf_ d.33.1.1 (F:) Bacterial protein-export protein SecB {Haemophilus influenzae [TaxId: 727]}
qpvlqiqriyvkdvsfeapnlphifqqewkpklgfdlstettqvgddlyevvlnisvett
ledsgdvaficevkqagvftisgledvqmahcltsqcpnmlfpyarelvsnlvnrgtfpa
lnlspvnfdalfveymnrqqaenaeeks

SCOPe Domain Coordinates for d1ozbf_:

Click to download the PDB-style file with coordinates for d1ozbf_.
(The format of our PDB-style files is described here.)

Timeline for d1ozbf_: