Lineage for d1ozbd_ (1ozb D:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 410564Fold d.33: Bacterial protein-export protein SecB [54610] (1 superfamily)
    beta(4)-alpha(2); two layers: alpha/beta; antiparallel sheet: order 1432
  4. 410565Superfamily d.33.1: Bacterial protein-export protein SecB [54611] (1 family) (S)
  5. 410566Family d.33.1.1: Bacterial protein-export protein SecB [54612] (1 protein)
  6. 410567Protein Bacterial protein-export protein SecB [54613] (2 species)
  7. 410573Species Haemophilus influenzae [TaxId:727] [54614] (2 PDB entries)
  8. 410581Domain d1ozbd_: 1ozb D: [93812]
    Other proteins in same PDB: d1ozbi_, d1ozbj_

Details for d1ozbd_

PDB Entry: 1ozb (more details), 2.8 Å

PDB Description: Crystal Structure of SecB complexed with SecA C-terminus

SCOP Domain Sequences for d1ozbd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ozbd_ d.33.1.1 (D:) Bacterial protein-export protein SecB {Haemophilus influenzae}
vlqiqriyvkdvsfeapnlphifqqewkpklgfdlstettqvgddlyevvlnisvettle
dsgdvaficevkqagvftisgledvqmahcltsqcpnmlfpyarelvsnlvnrgtfpaln
lspvnfdalfveymn

SCOP Domain Coordinates for d1ozbd_:

Click to download the PDB-style file with coordinates for d1ozbd_.
(The format of our PDB-style files is described here.)

Timeline for d1ozbd_: