Lineage for d1ozbb_ (1ozb B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1023611Fold d.33: SecB-like [54610] (1 superfamily)
    beta(4)-alpha(2); two layers: alpha/beta; antiparallel sheet: order 1432
  4. 1023612Superfamily d.33.1: SecB-like [54611] (2 families) (S)
  5. 1023613Family d.33.1.1: Bacterial protein-export protein SecB [54612] (1 protein)
  6. 1023614Protein Bacterial protein-export protein SecB [54613] (2 species)
  7. 1023620Species Haemophilus influenzae [TaxId:727] [54614] (2 PDB entries)
  8. 1023626Domain d1ozbb_: 1ozb B: [93810]
    Other proteins in same PDB: d1ozbi_, d1ozbj_
    complexed with zn

Details for d1ozbb_

PDB Entry: 1ozb (more details), 2.8 Å

PDB Description: Crystal Structure of SecB complexed with SecA C-terminus
PDB Compounds: (B:) protein-export protein secb

SCOPe Domain Sequences for d1ozbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ozbb_ d.33.1.1 (B:) Bacterial protein-export protein SecB {Haemophilus influenzae [TaxId: 727]}
qpvlqiqriyvkdvsfeapnlphifqqewkpklgfdlstettqvgddlyevvlnisvett
ledsgdvaficevkqagvftisgledvqmahcltsqcpnmlfpyarelvsnlvnrgtfpa
lnlspvnfdalfveymn

SCOPe Domain Coordinates for d1ozbb_:

Click to download the PDB-style file with coordinates for d1ozbb_.
(The format of our PDB-style files is described here.)

Timeline for d1ozbb_: