SCOPe 2.06: Domain d1oz9a_: 1oz9 A:

Lineage for d1oz9a_ (1oz9 A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.15: Predicted metal-dependent hydrolase [103132] (4 proteins)
   Pfam PF02130; UPF0054; COG0319; MMP-like fold with a different sequence motif in the putative active site

6. Protein Hypothetical protein Aq_1354 [103133] (1 species)

7. Species Aquifex aeolicus [TaxId:63363] [103134] (1 PDB entry)

8. Domain d1oz9a_: 1oz9 A: [93808]
   structural genomics

Details for d1oz9a_

PDB Entry: 1oz9, 1.89 Å

PDB Description: Crystal structure of AQ_1354, a hypothetical protein from Aquifex aeolicus

PDB Compounds: (A:) Hypothetical protein AQ_1354

SCOPe Domain Sequences for d1oz9a_:

Sequence; same for both SEQRES and ATOM records:

>d1oz9a_ d.92.1.15 (A:) Hypothetical protein Aq_1354 {Aquifex aeolicus [TaxId: 63363]}
knrvlvklkkrkvrkdkiekwaelalsalglnnvelsvyitddqeirelnktyrkkdkpt
dvlsfpmgeefggykilgdvvisqdtaerqarelghsleeevkrlivhgivhllgydhek
ggeeekkfrelenyvlsklsk

Timeline for d1oz9a_:

• d1oz9a_ first appeared in SCOP 1.67
  
• d1oz9a_ appears in SCOPe 2.05
  
• d1oz9a_ appears in SCOPe 2.07
  
• d1oz9a_ appears in the current release, SCOPe 2.08