Lineage for d1oz9a_ (1oz9 A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1423492Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1423493Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 1424439Family d.92.1.15: Predicted metal-dependent hydrolase [103132] (3 proteins)
    Pfam PF02130; UPF0054; COG0319; MMP-like fold with a different sequence motif in the putative active site
  6. 1424440Protein Hypothetical protein Aq_1354 [103133] (1 species)
  7. 1424441Species Aquifex aeolicus [TaxId:63363] [103134] (1 PDB entry)
  8. 1424442Domain d1oz9a_: 1oz9 A: [93808]
    structural genomics

Details for d1oz9a_

PDB Entry: 1oz9 (more details), 1.89 Å

PDB Description: Crystal structure of AQ_1354, a hypothetical protein from Aquifex aeolicus
PDB Compounds: (A:) Hypothetical protein AQ_1354

SCOPe Domain Sequences for d1oz9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oz9a_ d.92.1.15 (A:) Hypothetical protein Aq_1354 {Aquifex aeolicus [TaxId: 63363]}
knrvlvklkkrkvrkdkiekwaelalsalglnnvelsvyitddqeirelnktyrkkdkpt
dvlsfpmgeefggykilgdvvisqdtaerqarelghsleeevkrlivhgivhllgydhek
ggeeekkfrelenyvlsklsk

SCOPe Domain Coordinates for d1oz9a_:

Click to download the PDB-style file with coordinates for d1oz9a_.
(The format of our PDB-style files is described here.)

Timeline for d1oz9a_: