SCOP 1.67: Domain d1oz7b_: 1oz7 B:

Lineage for d1oz7b_ (1oz7 B:)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (6 families)

5. Family d.169.1.1: C-type lectin domain [56437] (22 proteins)

6. Protein Snake coagglutinin beta chain [88867] (9 species)
   heterodimeric coagulation factors IX/X-binding protein (IX/X-BP)

7. Species Saw-scaled viper (Echis carinatus), echicetin [TaxId:40353] [103350] (1 PDB entry)

8. Domain d1oz7b_: 1oz7 B: [93807]
   Other proteins in same PDB: d1oz7a_

Details for d1oz7b_

PDB Entry: 1oz7, 2.4 Å

PDB Description: Crystal structure of Echicetin from the venom of Indian saw-scaled viper (Echis carinatus) at 2.4 resolution

SCOP Domain Sequences for d1oz7b_:

Sequence; same for both SEQRES and ATOM records:

>d1oz7b_ d.169.1.1 (B:) Snake coagglutinin beta chain {Saw-scaled viper (Echis carinatus), echicetin}
nclpdwsvyegycykvfkermnwadaekfctkqhkdghlvsfrnskevdfvislafpmlk
ndlvwigltdywrdcnwewsdgaqldykawdnerhcfiykntdnqwtrrdctwtfsfvck
cpa

Timeline for d1oz7b_:

• d1oz7b_ is new in SCOP 1.67
  
• d1oz7b_ appears in SCOP 1.69
  
• d1oz7b_ appears in the current release, SCOPe 2.08