Lineage for d1oz7a_ (1oz7 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2607278Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2607279Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2607280Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 2607593Protein Snake coagglutinin alpha chain [88861] (10 species)
    heterodimeric coagulation factors IX/X-binding protein (IX/X-BP)
  7. 2607621Species Saw-scaled viper (Echis carinatus), echicetin [TaxId:40353] [103346] (1 PDB entry)
  8. 2607622Domain d1oz7a_: 1oz7 A: [93806]
    Other proteins in same PDB: d1oz7b_

Details for d1oz7a_

PDB Entry: 1oz7 (more details), 2.4 Å

PDB Description: Crystal structure of Echicetin from the venom of Indian saw-scaled viper (Echis carinatus) at 2.4 resolution
PDB Compounds: (A:) echicetin A-chain

SCOPe Domain Sequences for d1oz7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oz7a_ d.169.1.1 (A:) Snake coagglutinin alpha chain {Saw-scaled viper (Echis carinatus), echicetin [TaxId: 40353]}
mcppgwssngvycymlfkepktwdeaekfcnkqgkdghllsieskkeeilvdivvsenig
kmykiwtglserskeqhcssrwsdgsffrsyeiairysecfvlekqsvfrtwvatpcent
fpfmckypvpr

SCOPe Domain Coordinates for d1oz7a_:

Click to download the PDB-style file with coordinates for d1oz7a_.
(The format of our PDB-style files is described here.)

Timeline for d1oz7a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1oz7b_