Lineage for d1oz4c2 (1oz4 C:201-470)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 695085Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 695086Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 697666Family c.37.1.20: Extended AAA-ATPase domain [81269] (27 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 697860Protein Membrane fusion ATPase VCP/p97 [64038] (1 species)
  7. 697861Species Mouse (Mus musculus) [TaxId:10090] [64039] (4 PDB entries)
  8. 697869Domain d1oz4c2: 1oz4 C:201-470 [93802]
    Other proteins in same PDB: d1oz4a1, d1oz4a4, d1oz4b1, d1oz4b4, d1oz4c1, d1oz4c4

Details for d1oz4c2

PDB Entry: 1oz4 (more details), 4.7 Å

PDB Description: vcp/p97
PDB Compounds: (C:) Transitional endoplasmic reticulum ATPase

SCOP Domain Sequences for d1oz4c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oz4c2 c.37.1.20 (C:201-470) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]}
vgyddvggcrkqlaqikemvelplrhpalfkaigvkpprgillygppgtgktliaravan
etgaffflingpeimsklagesesnlrkafeeaeknapaiifideldaiapkrekthgev
errivsqlltlmdglkqrahvivmaatnrpnsidpalrrfgrfdrevdigipdatgrlei
lqihtknmkladdvdleqvanethghvgadlaalcseaalqairkkmdlidledetidae
vmnslavtmddfrwalsqsnpsalretvve

SCOP Domain Coordinates for d1oz4c2:

Click to download the PDB-style file with coordinates for d1oz4c2.
(The format of our PDB-style files is described here.)

Timeline for d1oz4c2: