![]() | Class b: All beta proteins [48724] (141 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (15 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.9: Tudor/PWWP/MBT [63748] (3 families) ![]() |
![]() | Family b.34.9.3: MBT repeat [89299] (2 proteins) contains extended 'arm', N-terminal to the common fold core |
![]() | Protein Lethal(3)malignant brain tumor-like protein [101686] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [101687] (3 PDB entries) |
![]() | Domain d1oz3c3: 1oz3 C:422-518 [93792] complexed with mes, so4 |
PDB Entry: 1oz3 (more details), 1.85 Å
SCOP Domain Sequences for d1oz3c3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oz3c3 b.34.9.3 (C:422-518) Lethal(3)malignant brain tumor-like protein {Human (Homo sapiens)} fcwekyleetgasavptwafkvrpphsflvnmkleavdrrnpalirvasvedvedhriki hfdgwshgydfwidadhpdihpagwcsktghplqppl
Timeline for d1oz3c3: