Lineage for d1oz3c2 (1oz3 C:314-421)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. Family b.34.9.3: MBT repeat [89299] (4 proteins)
    Pfam PF02820
    contains extended 'arm', N-terminal to the common fold core
  6. Protein Lethal(3)malignant brain tumor-like protein [101686] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [101687] (3 PDB entries)
  8. Domain d1oz3c2: 1oz3 C:314-421 [93791]
    complexed with mes, so4

Details for d1oz3c2

PDB Entry: 1oz3 (more details), 1.85 Å

PDB Description: Crystal Structure of 3-MBT repeats of lethal (3) malignant Brain Tumor (Native-I) at 1.85 angstrom
PDB Compounds: (C:) Lethal(3)malignant brain tumor-like protein

SCOPe Domain Sequences for d1oz3c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oz3c2 b.34.9.3 (C:314-421) Lethal(3)malignant brain tumor-like protein {Human (Homo sapiens) [TaxId: 9606]}
fswsqylrstraqaapkhlfvsqshsppplgfqvgmkleavdrmnpslvcvasvtdvvds
rflvhfdnwddtydywcdpsspyihpvgwcqkqgkpltppqdypdpdn

SCOPe Domain Coordinates for d1oz3c2 are not available.

Timeline for d1oz3c2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1oz3c1, d1oz3c3
View in 3D
Domains from other chains:
(mouse over for more information)
d1oz3a1, d1oz3a2, d1oz3a3, d1oz3b1, d1oz3b2, d1oz3b3