Lineage for d1oz3b3 (1oz3 B:422-518)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2784517Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. 2784756Family b.34.9.3: MBT repeat [89299] (4 proteins)
    Pfam PF02820
    contains extended 'arm', N-terminal to the common fold core
  6. 2784761Protein Lethal(3)malignant brain tumor-like protein [101686] (1 species)
  7. 2784762Species Human (Homo sapiens) [TaxId:9606] [101687] (3 PDB entries)
  8. 2784771Domain d1oz3b3: 1oz3 B:422-518 [93789]
    complexed with mes, so4

Details for d1oz3b3

PDB Entry: 1oz3 (more details), 1.85 Å

PDB Description: Crystal Structure of 3-MBT repeats of lethal (3) malignant Brain Tumor (Native-I) at 1.85 angstrom
PDB Compounds: (B:) Lethal(3)malignant brain tumor-like protein

SCOPe Domain Sequences for d1oz3b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oz3b3 b.34.9.3 (B:422-518) Lethal(3)malignant brain tumor-like protein {Human (Homo sapiens) [TaxId: 9606]}
fcwekyleetgasavptwafkvrpphsflvnmkleavdrrnpalirvasvedvedhriki
hfdgwshgydfwidadhpdihpagwcsktghplqppl

SCOPe Domain Coordinates for d1oz3b3:

Click to download the PDB-style file with coordinates for d1oz3b3.
(The format of our PDB-style files is described here.)

Timeline for d1oz3b3: