| Class b: All beta proteins [48724] (174 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.9: Tudor/PWWP/MBT [63748] (4 families) ![]() |
| Family b.34.9.3: MBT repeat [89299] (4 proteins) Pfam PF02820 contains extended 'arm', N-terminal to the common fold core |
| Protein Lethal(3)malignant brain tumor-like protein [101686] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [101687] (3 PDB entries) |
| Domain d1oz3a1: 1oz3 A:206-313 [93784] |
PDB Entry: 1oz3 (more details), 1.85 Å
SCOP Domain Sequences for d1oz3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oz3a1 b.34.9.3 (A:206-313) Lethal(3)malignant brain tumor-like protein {Human (Homo sapiens) [TaxId: 9606]}
wswesyleeqkaitapvslfqdsqavthnkngfklgmklegidpqhpsmyfiltvaevcg
yrlrlhfdgysechdfwvnanspdihpagwfektghklqppkgykeee
Timeline for d1oz3a1: