Lineage for d1oz2a3 (1oz2 A:422-527)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 372425Fold b.34: SH3-like barrel [50036] (15 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 372967Superfamily b.34.9: Tudor/PWWP/MBT [63748] (3 families) (S)
  5. 372983Family b.34.9.3: MBT repeat [89299] (2 proteins)
    contains extended 'arm', N-terminal to the common fold core
  6. 372984Protein Lethal(3)malignant brain tumor-like protein [101686] (1 species)
  7. 372985Species Human (Homo sapiens) [TaxId:9606] [101687] (3 PDB entries)
  8. 372988Domain d1oz2a3: 1oz2 A:422-527 [93783]
    complexed with mes, so4

Details for d1oz2a3

PDB Entry: 1oz2 (more details), 1.55 Å

PDB Description: crystal structure of 3-mbt repeats of lethal (3) malignant brain tumor (native-ii) at 1.55 angstrom

SCOP Domain Sequences for d1oz2a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oz2a3 b.34.9.3 (A:422-527) Lethal(3)malignant brain tumor-like protein {Human (Homo sapiens)}
fcwekyleetgasavptwafkvrpphsflvnmkleavdrrnpalirvasvedvedhriki
hfdgwshgydfwidadhpdihpagwcsktghplqpplgprepssas

SCOP Domain Coordinates for d1oz2a3:

Click to download the PDB-style file with coordinates for d1oz2a3.
(The format of our PDB-style files is described here.)

Timeline for d1oz2a3: