Lineage for d1oz1a_ (1oz1 A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 419158Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 419159Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 419200Family d.144.1.7: Protein kinases, catalytic subunit [88854] (47 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 419568Protein MAP kinase p38 [56129] (2 species)
    CMGC group; ERK/MAPK subfamily; serine/threonine kinase
  7. 419569Species Human (Homo sapiens) [TaxId:9606] [56130] (16 PDB entries)
  8. 419572Domain d1oz1a_: 1oz1 A: [93780]
    complexed with fph

Details for d1oz1a_

PDB Entry: 1oz1 (more details), 2.1 Å

PDB Description: p38 mitogen-activated kinase in complex with 4-azaindole inhibitor

SCOP Domain Sequences for d1oz1a_:

Sequence, based on SEQRES records: (download)

>d1oz1a_ d.144.1.7 (A:) MAP kinase p38 {Human (Homo sapiens)}
rptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsiih
akrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqkltd
dhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemtgyva
trwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpga
ellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqala
hayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvppp

Sequence, based on observed residues (ATOM records): (download)

>d1oz1a_ d.144.1.7 (A:) MAP kinase p38 {Human (Homo sapiens)}
rptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsiih
akrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivltddhvq
fliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemtgyvatrwy
rapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellk
kissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqalahayf
aqyhdpddepvadpydqsfesrdllidewksltydevisfvppp

SCOP Domain Coordinates for d1oz1a_:

Click to download the PDB-style file with coordinates for d1oz1a_.
(The format of our PDB-style files is described here.)

Timeline for d1oz1a_: