Lineage for d1oyya3 (1oyy A:207-406)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 581392Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 581393Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) (S)
    division into families based on beta-sheet topologies
  5. 583265Family c.37.1.19: Tandem AAA-ATPase domain [81268] (13 proteins)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. 583343Protein RecQ helicase domain [102385] (1 species)
  7. 583344Species Escherichia coli [TaxId:562] [102386] (2 PDB entries)
  8. 583348Domain d1oyya3: 1oyy A:207-406 [93774]
    Other proteins in same PDB: d1oyya1
    complexed with ags, mn, zn

Details for d1oyya3

PDB Entry: 1oyy (more details), 2.5 Å

PDB Description: structure of the recq catalytic core bound to atp-gamma-s

SCOP Domain Sequences for d1oyya3:

Sequence, based on SEQRES records: (download)

>d1oyya3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli}
sfdrpnirymlmekfkpldqlmryvqeqrgksgiiycnsrakvedtaarlqskgisaaay
haglennvradvqekfqrddlqivvatvafgmginkpnvrfvvhfdiprniesyyqetgr
agrdglpaeamlfydpadmawlrrcleekpqgqlqdierhklnamgafaeaqtcrrlvll
nyfgegrqepcgncdicldp

Sequence, based on observed residues (ATOM records): (download)

>d1oyya3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli}
sfdrpnirymlmekfkpldqlmryvqeqrgksgiiycnsrakvedtaarlqskgisaaay
haglennvradvqekfqrddlqivvatvainkpnvrfvvhfdiprniesyyqetgragrd
glpaeamlfydpadmawlrrcleekpqgqlqdierhklnamgafaeaqtcrrlvllnyfg
egrqepcgncdicldp

SCOP Domain Coordinates for d1oyya3:

Click to download the PDB-style file with coordinates for d1oyya3.
(The format of our PDB-style files is described here.)

Timeline for d1oyya3: