Lineage for d1oyya3 (1oyy A:207-406)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113231Family c.37.1.19: Tandem AAA-ATPase domain [81268] (24 protein domains)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. 2113385Protein RecQ helicase domain [102385] (1 species)
  7. 2113386Species Escherichia coli [TaxId:562] [102386] (2 PDB entries)
  8. 2113390Domain d1oyya3: 1oyy A:207-406 [93774]
    Other proteins in same PDB: d1oyya1
    complexed with ags, mn, zn

Details for d1oyya3

PDB Entry: 1oyy (more details), 2.5 Å

PDB Description: Structure of the RecQ Catalytic Core bound to ATP-gamma-S
PDB Compounds: (A:) ATP-dependent DNA helicase

SCOPe Domain Sequences for d1oyya3:

Sequence, based on SEQRES records: (download)

>d1oyya3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]}
sfdrpnirymlmekfkpldqlmryvqeqrgksgiiycnsrakvedtaarlqskgisaaay
haglennvradvqekfqrddlqivvatvafgmginkpnvrfvvhfdiprniesyyqetgr
agrdglpaeamlfydpadmawlrrcleekpqgqlqdierhklnamgafaeaqtcrrlvll
nyfgegrqepcgncdicldp

Sequence, based on observed residues (ATOM records): (download)

>d1oyya3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]}
sfdrpnirymlmekfkpldqlmryvqeqrgksgiiycnsrakvedtaarlqskgisaaay
haglennvradvqekfqrddlqivvatvainkpnvrfvvhfdiprniesyyqetgragrd
glpaeamlfydpadmawlrrcleekpqgqlqdierhklnamgafaeaqtcrrlvllnyfg
egrqepcgncdicldp

SCOPe Domain Coordinates for d1oyya3:

Click to download the PDB-style file with coordinates for d1oyya3.
(The format of our PDB-style files is described here.)

Timeline for d1oyya3: