SCOPe 2.08: Domain d1oyya3: 1oyy A:207-406

Lineage for d1oyya3 (1oyy A:207-406)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.19: Tandem AAA-ATPase domain [81268] (41 proteins)
   duplication: tandem repeat of two RecA-like (AAA) domains

6. Protein RecQ helicase domain [102385] (1 species)

7. Species Escherichia coli [TaxId:562] [102386] (2 PDB entries)

8. Domain d1oyya3: 1oyy A:207-406 [93774]
   Other proteins in same PDB: d1oyya1
   complexed with ags, mn, zn
   has additional insertions and/or extensions that are not grouped together

Details for d1oyya3

PDB Entry: 1oyy, 2.5 Å

PDB Description: structure of the recq catalytic core bound to atp-gamma-s

PDB Compounds: (A:) ATP-dependent DNA helicase

SCOPe Domain Sequences for d1oyya3:

Sequence, based on SEQRES records:

>d1oyya3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]}
sfdrpnirymlmekfkpldqlmryvqeqrgksgiiycnsrakvedtaarlqskgisaaay
haglennvradvqekfqrddlqivvatvafgmginkpnvrfvvhfdiprniesyyqetgr
agrdglpaeamlfydpadmawlrrcleekpqgqlqdierhklnamgafaeaqtcrrlvll
nyfgegrqepcgncdicldp

Sequence, based on observed residues (ATOM records):

>d1oyya3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]}
sfdrpnirymlmekfkpldqlmryvqeqrgksgiiycnsrakvedtaarlqskgisaaay
haglennvradvqekfqrddlqivvatvainkpnvrfvvhfdiprniesyyqetgragrd
glpaeamlfydpadmawlrrcleekpqgqlqdierhklnamgafaeaqtcrrlvllnyfg
egrqepcgncdicldp

Timeline for d1oyya3:

• d1oyya3 first appeared in SCOP 1.67
  
• d1oyya3 appears in SCOPe 2.07