Lineage for d1oyya2 (1oyy A:1-206)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 695085Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 695086Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 697477Family c.37.1.19: Tandem AAA-ATPase domain [81268] (22 proteins)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. 697618Protein RecQ helicase domain [102385] (1 species)
  7. 697619Species Escherichia coli [TaxId:562] [102386] (2 PDB entries)
  8. 697622Domain d1oyya2: 1oyy A:1-206 [93773]
    Other proteins in same PDB: d1oyya1

Details for d1oyya2

PDB Entry: 1oyy (more details), 2.5 Å

PDB Description: structure of the recq catalytic core bound to atp-gamma-s
PDB Compounds: (A:) ATP-dependent DNA helicase

SCOP Domain Sequences for d1oyya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oyya2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]}
maqaevlnlesgakqvlqetfgyqqfrpgqeeiidtvlsgrdclvvmptgggkslcyqip
alllngltvvvsplislmkdqvdqlqangvaaaclnstqtreqqlevmtgcrtgqirlly
iaperlmldnflehlahwnpvllavdeahcisqwghdfrpeyaalgqlrqrfptlpfmal
tataddttrqdivrllglndpliqis

SCOP Domain Coordinates for d1oyya2:

Click to download the PDB-style file with coordinates for d1oyya2.
(The format of our PDB-style files is described here.)

Timeline for d1oyya2: