SCOP 1.73: Domain d1oyya1: 1oyy A:407-516

Lineage for d1oyya1 (1oyy A:407-516)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (68 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.43: RecQ helicase DNA-binding domain-like [101030] (2 proteins)
   follows the tandem AAA-ATPase domain

6. Protein DNA helicase RecQ DNA-binding domain [101031] (1 species)

7. Species Escherichia coli [TaxId:562] [101032] (2 PDB entries)

8. Domain d1oyya1: 1oyy A:407-516 [93772]
   Other proteins in same PDB: d1oyya2, d1oyya3
   complexed with ags, mn, zn

Details for d1oyya1

PDB Entry: 1oyy, 2.5 Å

PDB Description: structure of the recq catalytic core bound to atp-gamma-s

PDB Compounds: (A:) ATP-dependent DNA helicase

SCOP Domain Sequences for d1oyya1:

Sequence; same for both SEQRES and ATOM records:

>d1oyya1 a.4.5.43 (A:407-516) DNA helicase RecQ DNA-binding domain {Escherichia coli [TaxId: 562]}
pkqydgstdaqialstigrvnqrfgmgyvvevirgannqrirdyghdklkvygmgrdksh
ehwvsvirqlihlglvtqniaqhsalqlteaarpvlrgesslqlavpriv

Timeline for d1oyya1:

• d1oyya1 first appeared in SCOP 1.67
  
• d1oyya1 appears in SCOP 1.71
  
• d1oyya1 appears in SCOP 1.75
  
• d1oyya1 appears in the current release, SCOPe 2.08