Lineage for d1oyya1 (1oyy A:407-516)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 532780Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 533238Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (61 families) (S)
    contains a small beta-sheet (wing)
  5. 533836Family a.4.5.43: DNA helicase RecQ DNA-binding domain [101030] (1 protein)
    follows the tandem AAA-ATPase domain
  6. 533837Protein DNA helicase RecQ DNA-binding domain [101031] (1 species)
  7. 533838Species Escherichia coli [TaxId:562] [101032] (2 PDB entries)
  8. 533840Domain d1oyya1: 1oyy A:407-516 [93772]
    Other proteins in same PDB: d1oyya2, d1oyya3
    complexed with ags, mn, zn

Details for d1oyya1

PDB Entry: 1oyy (more details), 2.5 Å

PDB Description: structure of the recq catalytic core bound to atp-gamma-s

SCOP Domain Sequences for d1oyya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oyya1 a.4.5.43 (A:407-516) DNA helicase RecQ DNA-binding domain {Escherichia coli}
pkqydgstdaqialstigrvnqrfgmgyvvevirgannqrirdyghdklkvygmgrdksh
ehwvsvirqlihlglvtqniaqhsalqlteaarpvlrgesslqlavpriv

SCOP Domain Coordinates for d1oyya1:

Click to download the PDB-style file with coordinates for d1oyya1.
(The format of our PDB-style files is described here.)

Timeline for d1oyya1: