Lineage for d1oyxc3 (1oyx C:422-518)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1783288Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1784737Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. 1784862Family b.34.9.3: MBT repeat [89299] (4 proteins)
    Pfam PF02820
    contains extended 'arm', N-terminal to the common fold core
  6. 1784867Protein Lethal(3)malignant brain tumor-like protein [101686] (1 species)
  7. 1784868Species Human (Homo sapiens) [TaxId:9606] [101687] (3 PDB entries)
  8. 1784889Domain d1oyxc3: 1oyx C:422-518 [93771]
    complexed with mes, so4

Details for d1oyxc3

PDB Entry: 1oyx (more details), 1.85 Å

PDB Description: crystal structure of 3-mbt repeats of lethal (3) malignant brain tumor (seleno-met) at 1.85 angstrom
PDB Compounds: (C:) Lethal(3)malignant brain tumor-like protein

SCOPe Domain Sequences for d1oyxc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oyxc3 b.34.9.3 (C:422-518) Lethal(3)malignant brain tumor-like protein {Human (Homo sapiens) [TaxId: 9606]}
fcwekyleetgasavptwafkvrpphsflvnmkleavdrrnpalirvasvedvedhriki
hfdgwshgydfwidadhpdihpagwcsktghplqppl

SCOPe Domain Coordinates for d1oyxc3:

Click to download the PDB-style file with coordinates for d1oyxc3.
(The format of our PDB-style files is described here.)

Timeline for d1oyxc3: