SCOPe 2.06: Domain d1oywa3: 1oyw A:207-406

Lineage for d1oywa3 (1oyw A:207-406)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.19: Tandem AAA-ATPase domain [81268] (24 proteins)
   duplication: tandem repeat of two RecA-like (AAA) domains

6. Protein RecQ helicase domain [102385] (1 species)

7. Species Escherichia coli [TaxId:562] [102386] (2 PDB entries)

8. Domain d1oywa3: 1oyw A:207-406 [93762]
   Other proteins in same PDB: d1oywa1
   complexed with mn, zn

Details for d1oywa3

PDB Entry: 1oyw, 1.8 Å

PDB Description: structure of the recq catalytic core

PDB Compounds: (A:) ATP-dependent DNA helicase

SCOPe Domain Sequences for d1oywa3:

Sequence; same for both SEQRES and ATOM records:

>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]}
sfdrpnirymlmekfkpldqlmryvqeqrgksgiiycnsrakvedtaarlqskgisaaay
haglennvradvqekfqrddlqivvatvafgmginkpnvrfvvhfdiprniesyyqetgr
agrdglpaeamlfydpadmawlrrcleekpqgqlqdierhklnamgafaeaqtcrrlvll
nyfgegrqepcgncdicldp

Timeline for d1oywa3:

• d1oywa3 first appeared in SCOP 1.67
  
• d1oywa3 appears in SCOPe 2.05
  
• d1oywa3 appears in SCOPe 2.07
  
• d1oywa3 appears in the current release, SCOPe 2.08