Lineage for d1oyrd1 (1oyr D:1-151)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 598219Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 598220Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families) (S)
  5. 598334Family d.14.1.4: Ribonuclease PH domain 1-like [54229] (2 proteins)
  6. 598341Protein Ribonuclease PH, domain 1 [102758] (3 species)
  7. 598347Species Bacillus subtilis [TaxId:1423] [102761] (3 PDB entries)
  8. 598358Domain d1oyrd1: 1oyr D:1-151 [93752]
    Other proteins in same PDB: d1oyra2, d1oyrb2, d1oyrc2, d1oyrd2, d1oyre2, d1oyrf2

Details for d1oyrd1

PDB Entry: 1oyr (more details), 3.1 Å

PDB Description: Crystal structure of the phosphorolytic exoribonuclease RNase PH from Bacillus subtilis

SCOP Domain Sequences for d1oyrd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oyrd1 d.14.1.4 (D:1-151) Ribonuclease PH, domain 1 {Bacillus subtilis}
mrhdgrqhdelrpitfdldfishpegsvlitagntkvicnasvedrvppflrgggkgwit
aeysmlpratnqrtiresskgkisgrtmeiqrligralravvdleklgertiwidcdviq
adggtrtasitgaflamaiaigklikagtik

SCOP Domain Coordinates for d1oyrd1:

Click to download the PDB-style file with coordinates for d1oyrd1.
(The format of our PDB-style files is described here.)

Timeline for d1oyrd1: