SCOPe 2.05: Domain d1oyrb1: 1oyr B:1-151

Lineage for d1oyrb1 (1oyr B:1-151)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.4: Ribonuclease PH domain 1-like [54229] (11 proteins)

6. Protein Ribonuclease PH, domain 1 [102758] (4 species)

7. Species Bacillus subtilis [TaxId:1423] [102761] (3 PDB entries)

8. Domain d1oyrb1: 1oyr B:1-151 [93748]
   Other proteins in same PDB: d1oyra2, d1oyrb2, d1oyrc2, d1oyrd2, d1oyre2, d1oyrf2
   complexed with cd, so4

Details for d1oyrb1

PDB Entry: 1oyr, 3.1 Å

PDB Description: Crystal structure of the phosphorolytic exoribonuclease RNase PH from Bacillus subtilis

PDB Compounds: (B:) Ribonuclease PH

SCOPe Domain Sequences for d1oyrb1:

Sequence; same for both SEQRES and ATOM records:

>d1oyrb1 d.14.1.4 (B:1-151) Ribonuclease PH, domain 1 {Bacillus subtilis [TaxId: 1423]}
mrhdgrqhdelrpitfdldfishpegsvlitagntkvicnasvedrvppflrgggkgwit
aeysmlpratnqrtiresskgkisgrtmeiqrligralravvdleklgertiwidcdviq
adggtrtasitgaflamaiaigklikagtik

Timeline for d1oyrb1:

• d1oyrb1 first appeared in SCOP 1.67
  
• d1oyrb1 appears in SCOPe 2.04
  
• d1oyrb1 appears in SCOPe 2.06
  
• d1oyrb1 appears in the current release, SCOPe 2.08