Lineage for d1oyra2 (1oyr A:152-242)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2967341Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134
  4. 2967342Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (2 families) (S)
  5. 2967343Family d.101.1.1: Ribonuclease PH domain 2-like [55667] (11 proteins)
  6. 2967461Protein Ribonuclease PH, domain 2 [103150] (4 species)
  7. 2967469Species Bacillus subtilis [TaxId:1423] [103153] (3 PDB entries)
  8. 2967477Domain d1oyra2: 1oyr A:152-242 [93747]
    Other proteins in same PDB: d1oyra1, d1oyrb1, d1oyrc1, d1oyrd1, d1oyre1, d1oyrf1
    complexed with cd, so4

Details for d1oyra2

PDB Entry: 1oyr (more details), 3.1 Å

PDB Description: Crystal structure of the phosphorolytic exoribonuclease RNase PH from Bacillus subtilis
PDB Compounds: (A:) Ribonuclease PH

SCOPe Domain Sequences for d1oyra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oyra2 d.101.1.1 (A:152-242) Ribonuclease PH, domain 2 {Bacillus subtilis [TaxId: 1423]}
tnpitdflaaisvgidkeqgilldlnyeedssaevdmnvimtgsgrfvelqgtgeeatfs
redlngllglaekgiqelidkqkevlgdslp

SCOPe Domain Coordinates for d1oyra2:

Click to download the PDB-style file with coordinates for d1oyra2.
(The format of our PDB-style files is described here.)

Timeline for d1oyra2: