Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily) beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134 |
Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (2 families) |
Family d.101.1.1: Ribonuclease PH domain 2-like [55667] (11 proteins) |
Protein Ribonuclease PH, domain 2 [103150] (4 species) |
Species Bacillus subtilis [TaxId:1423] [103153] (3 PDB entries) |
Domain d1oyra2: 1oyr A:152-242 [93747] Other proteins in same PDB: d1oyra1, d1oyrb1, d1oyrc1, d1oyrd1, d1oyre1, d1oyrf1 complexed with cd, so4 |
PDB Entry: 1oyr (more details), 3.1 Å
SCOPe Domain Sequences for d1oyra2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oyra2 d.101.1.1 (A:152-242) Ribonuclease PH, domain 2 {Bacillus subtilis [TaxId: 1423]} tnpitdflaaisvgidkeqgilldlnyeedssaevdmnvimtgsgrfvelqgtgeeatfs redlngllglaekgiqelidkqkevlgdslp
Timeline for d1oyra2: