SCOP 1.71: Domain d1oylb_: 1oyl B:

Lineage for d1oylb_ (1oyl B:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (4 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (2 proteins)

6. Protein Heme oxygenase-1 (HO-1) [48615] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48616] (14 PDB entries)

8. Domain d1oylb_: 1oyl B: [93733]
   complexed with hem; mutant

Details for d1oylb_

PDB Entry: 1oyl, 1.59 Å

PDB Description: crystal structures of the ferric, ferrous, and ferrous-no forms of the asp140ala mutant of human heme oxygenase-1: catalytic implications

SCOP Domain Sequences for d1oylb_:

Sequence; same for both SEQRES and ATOM records:

>d1oylb_ a.132.1.1 (B:) Heme oxygenase-1 (HO-1) {Human (Homo sapiens)}
pqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyvaleeeiernk
espvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepell
vahaytrylgalsggqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyrsrmnsl
emtpavrqrvieeaktafllniqlfeelqellth

Timeline for d1oylb_:

• d1oylb_ first appeared in SCOP 1.67
  
• d1oylb_ appears in SCOP 1.69
  
• d1oylb_ appears in SCOP 1.73
  
• d1oylb_ appears in the current release, SCOPe 2.08