SCOP 1.67: Domain d1oyla_: 1oyl A:

Lineage for d1oyla_ (1oyl A:)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (4 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (2 proteins)

6. Protein Heme oxygenase-1 (HO-1) [48615] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48616] (9 PDB entries)

8. Domain d1oyla_: 1oyl A: [93732]

Details for d1oyla_

PDB Entry: 1oyl, 1.59 Å

PDB Description: crystal structures of the ferric, ferrous, and ferrous-no forms of the asp140ala mutant of human heme oxygenase-1: catalytic implications

SCOP Domain Sequences for d1oyla_:

Sequence; same for both SEQRES and ATOM records:

>d1oyla_ a.132.1.1 (A:) Heme oxygenase-1 (HO-1) {Human (Homo sapiens)}
pqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyvaleeeiernk
espvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepell
vahaytrylgalsggqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyrsrmnsl
emtpavrqrvieeaktafllniqlfeelqellth

Timeline for d1oyla_:

• d1oyla_ is new in SCOP 1.67
  
• d1oyla_ appears in SCOP 1.69
  
• d1oyla_ appears in the current release, SCOPe 2.08