Lineage for d1oykb_ (1oyk B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2345656Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 2345657Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 2345658Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 proteins)
    automatically mapped to Pfam PF01126
  6. 2345704Protein Heme oxygenase-1 (HO-1) [48615] (3 species)
  7. 2345705Species Human (Homo sapiens) [TaxId:9606] [48616] (26 PDB entries)
    Uniprot P09601
  8. 2345757Domain d1oykb_: 1oyk B: [93731]
    complexed with hem; mutant

Details for d1oykb_

PDB Entry: 1oyk (more details), 2.59 Å

PDB Description: crystal structures of the ferric, ferrous, and ferrous-no forms of the asp140ala mutant of human heme oxygenase-1: catalytic implications
PDB Compounds: (B:) Heme oxygenase 1

SCOPe Domain Sequences for d1oykb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oykb_ a.132.1.1 (B:) Heme oxygenase-1 (HO-1) {Human (Homo sapiens) [TaxId: 9606]}
pqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyvaleeeiernk
espvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepell
vahaytrylgalsggqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyrsrmnsl
emtpavrqrvieeaktafllniqlfeelqellth

SCOPe Domain Coordinates for d1oykb_:

Click to download the PDB-style file with coordinates for d1oykb_.
(The format of our PDB-style files is described here.)

Timeline for d1oykb_: