Lineage for d1oyia_ (1oyi A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 351236Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 351617Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (45 families) (S)
    contains a small beta-sheet (wing)
  5. 351819Family a.4.5.19: Z-DNA binding domain [46853] (3 proteins)
  6. 351823Protein dsRNA-binding protein E3 (E3L) [101043] (1 species)
  7. 351824Species Vaccinia virus [TaxId:10245] [101044] (1 PDB entry)
  8. 351825Domain d1oyia_: 1oyi A: [93729]

Details for d1oyia_

PDB Entry: 1oyi (more details)

PDB Description: solution structure of the z-dna binding domain of the vaccinia virus gene e3l

SCOP Domain Sequences for d1oyia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oyia_ a.4.5.19 (A:) dsRNA-binding protein E3 (E3L) {Vaccinia virus}
rsnaeivceaiktigiegataaqltrqlnmekrevnkalydlqrsamvyssddipprwfm
tt

SCOP Domain Coordinates for d1oyia_:

Click to download the PDB-style file with coordinates for d1oyia_.
(The format of our PDB-style files is described here.)

Timeline for d1oyia_: